SCOPe 2.06: Structural Classification of Proteins

PDB entry 3mfm

View 3mfm on RCSB PDB site
Description: Crystal Structures and Mutational Analyses of Acyl-CoA Carboxylase Subunit of Streptomyces coelicolor
Class: Ligase
Keywords: ACCase, PCCase, ACC, PCC, Propionyl-CoA, CT, Carboxyltransferase, Polyketide, Fatty Acid, PKS, FAS, Polyketide Synthase, Fatty Acid Synthase, Carboxylase, beta subunit, PccB, Acyl-CoA, Acyl-CoA Carboxylase, Biotin, Ligase
Deposited on 2010-04-02, released 2010-10-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.227
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: propionyl-CoA carboxylase complex B subunit
Species: Streptomyces coelicolor [TaxId:1902]
Gene: pccB, SCK13.18c, SCO4926
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X4K7 (Start-529)
  - engineered mutation (421)
Domains in SCOPe 2.06: d3mfma1, d3mfma2
Chain 'B':
Compound: propionyl-CoA carboxylase complex B subunit
Species: Streptomyces coelicolor [TaxId:1902]
Gene: pccB, SCK13.18c, SCO4926
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X4K7 (Start-529)
  - engineered mutation (421)
Domains in SCOPe 2.06: d3mfmb1, d3mfmb2
Chain 'C':
Compound: propionyl-CoA carboxylase complex B subunit
Species: Streptomyces coelicolor [TaxId:1902]
Gene: pccB, SCK13.18c, SCO4926
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X4K7 (Start-529)
  - engineered mutation (421)
Domains in SCOPe 2.06: d3mfmc1, d3mfmc2
Chain 'D':
Compound: propionyl-CoA carboxylase complex B subunit
Species: Streptomyces coelicolor [TaxId:1902]
Gene: pccB, SCK13.18c, SCO4926
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X4K7 (Start-529)
  - engineered mutation (421)
Domains in SCOPe 2.06: d3mfmd1, d3mfmd2
Chain 'E':
Compound: propionyl-CoA carboxylase complex B subunit
Species: Streptomyces coelicolor [TaxId:1902]
Gene: pccB, SCK13.18c, SCO4926
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X4K7 (Start-529)
  - engineered mutation (421)
Domains in SCOPe 2.06: d3mfme1, d3mfme2
Chain 'F':
Compound: propionyl-CoA carboxylase complex B subunit
Species: Streptomyces coelicolor [TaxId:1902]
Gene: pccB, SCK13.18c, SCO4926
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X4K7 (Start-529)
  - engineered mutation (421)
Domains in SCOPe 2.06: d3mfmf1, d3mfmf2

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3mfmA (A:)
msepeeqqpdihttagkladlrrrieeathagsaravekqhakgkltareridllldegs
fveldefarhrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqk
ivkvmdfalktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpc
aggavyspaitdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhm
agdekdaveyvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhs
viehvlddaeffetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfv
rtcdafnvpvltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafgga
ynvmgskhlgadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyeda
llnpytaaergyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl