PDB entry 3mfj

View 3mfj on RCSB PDB site
Description: Bovine trypsin at 0.8 A resolution, restrained refinement
Class: hydrolase
Keywords: Trypsin, serine proteinase, HYDROLASE
Deposited on 2010-04-02, released 2010-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 0.8 Å
R-factor: 0.105
AEROSPACI score: 1.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mfja_
  • Heterogens: CA, BEN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mfjA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn