PDB entry 3mfg

View 3mfg on RCSB PDB site
Description: Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)
Class: toxin/immune system
Keywords: Bacterial Toxins, Enterotoxins, Epitopes, Protein Binding, Receptors, Antigen, T-Cell, alpha-beta, Signal Transduction, Superantigens, T-Cell Antigen Receptor Specificity, TOXIN-IMMUNE SYSTEM complex
Deposited on 2010-04-02, released 2010-11-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.237
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: tst, SA1819
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3mfga1, d3mfga2
  • Chain 'B':
    Compound: V_segment translation product
    Species: Homo sapiens [TaxId:9606]
    Gene: TCRBV2S1
    Database cross-references and differences (RAF-indexed):
    • PDB 3MFG (Start-117)
    Domains in SCOPe 2.04: d3mfgb_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mfgA (A:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfgA (A:)
    dnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkgekvd
    lntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfdkkq
    laistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekppini
    deiktieaein
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mfgB (B:)
    gavvsqhpsrvivksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsnegskatyeq
    gvekdkflinhasltlstltvtsahpedsgfyicsalagsgsstdtqyfgpgtrltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfgB (B:)
    avvsqhpsrvivksgtsvkiecrsldfqattmfwyrqfpslmlmatsnegskatyeqgve
    kdkflinhasltlstltvtsahpedsgfyicsalagdtqyfgpgtrltvl