PDB entry 3mez

View 3mez on RCSB PDB site
Description: X-ray structural analysis of a mannose specific lectin from dutch crocus (crocus vernus)
Class: sugar binding protein
Keywords: Lectin, Crocus, Heterotetramer, SUGAR BINDING PROTEIN
Deposited on 2010-04-01, released 2011-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.18
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannose-specific lectin 3 chain 1
    Species: Crocus vernus [TaxId:87752]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P86626 (0-109)
      • see remark 999 (11)
      • see remark 999 (50)
      • see remark 999 (83)
      • see remark 999 (89)
      • see remark 999 (110)
    Domains in SCOPe 2.07: d3meza_
  • Chain 'B':
    Compound: Mannose-specific lectin 3 chain 2
    Species: Crocus vernus [TaxId:87752]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P86626 (0-111)
      • see remark 999 (14)
      • see remark 999 (41-42)
      • see remark 999 (46)
      • see remark 999 (67)
      • see remark 999 (77)
      • see remark 999 (112)
    Domains in SCOPe 2.07: d3mezb_
  • Chain 'C':
    Compound: Mannose-specific lectin 3 chain 1
    Species: Crocus vernus [TaxId:87752]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P86626 (0-109)
      • see remark 999 (11)
      • see remark 999 (50)
      • see remark 999 (83)
      • see remark 999 (89)
    Domains in SCOPe 2.07: d3mezc_
  • Chain 'D':
    Compound: Mannose-specific lectin 3 chain 2
    Species: Crocus vernus [TaxId:87752]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P86626 (0-111)
      • see remark 999 (14)
      • see remark 999 (41-42)
      • see remark 999 (46)
      • see remark 999 (67)
      • see remark 999 (77)
    Domains in SCOPe 2.07: d3mezd_
  • Heterogens: GOL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mezA (A:)
    dnnvlltgdvihtdnqlsyesaafvmqgdcnlvlyneaggfqsnthgrgvdctlrlnnrg
    qleihsansntpvwvyprsvntvrgnyaatlgpdqhvtiygpaiwstpaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mezB (B:)
    niprvrnvlfssqvmydnaqlatrdyslvmrddcnlvltkgsktnivwesgtsgrgqhcf
    mrlghsgelditddrlntvfvsntvgqegdyvlilqingqavvygpavwstaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mezC (C:)
    dnnvlltgdvihtdnqlsyesaafvmqgdcnlvlyneaggfqsnthgrgvdctlrlnnrg
    qleihsansntpvwvyprsvntvrgnyaatlgpdqhvtiygpaiwstpaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mezC (C:)
    dnnvlltgdvihtdnqlsyesaafvmqgdcnlvlyneaggfqsnthgrgvdctlrlnnrg
    qleihsansntpvwvyprsvntvrgnyaatlgpdqhvtiygpaiwstpaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mezD (D:)
    niprvrnvlfssqvmydnaqlatrdyslvmrddcnlvltkgsktnivwesgtsgrgqhcf
    mrlghsgelditddrlntvfvsntvgqegdyvlilqingqavvygpavwstaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mezD (D:)
    niprvrnvlfssqvmydnaqlatrdyslvmrddcnlvltkgsktnivwesgtsgrgqhcf
    mrlghsgelditddrlntvfvsntvgqegdyvlilqingqavvygpavwsta