PDB entry 3mef

View 3mef on RCSB PDB site
Description: major cold-shock protein from escherichia coli solution nmr structure
Class: gene regulation
Keywords: cold-shock protein, transcription regulation, single-stranded RNA/DNA binding, ob fold, greek-key topology, RNA chaperone, aromatic-base stacking interactions, gene regulation
Deposited on 1998-10-09, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cold-shock protein a)
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene: U60035
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3mefa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mefA (A:)
    sgkmtgivkwfnadkgfgfitpddgskdvfvhfsaiqndgyksldegqkvsftiesgakg
    paagnvtsl