PDB entry 3meb

View 3meb on RCSB PDB site
Description: Structure of cytoplasmic aspartate aminotransferase from giardia lamblia
Class: transferase
Keywords: ASPARTATE AMINOTRANSFERASE, Aminotransferase, Pyridoxal phosphate, Transferase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2010-03-31, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Giardia lamblia [TaxId:184922]
    Gene: GL50803_91056
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3meba_
  • Chain 'B':
    Compound: aspartate aminotransferase
    Species: Giardia lamblia [TaxId:184922]
    Gene: GL50803_91056
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mebb_
  • Heterogens: SO4, PLP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mebA (A:)
    mahhhhhhmgtleaqtqgpgsmsvfsgfpasppdailnltvlynadtnpkkvnlgvgayr
    desgkpwilpavkeaeaiissdlskynkeyppvagfplfleaaqflmfgkdskaaqegri
    ascqslsgtgslhigfeflhlwmpkaefympsttwpnhygiydkvfnklkvpykeytylr
    kdgeleidfsntkkdiqsapeksiflfhacahnpsgidfteaqwkellpimkekkhiaff
    dsayqgfatgsfeadafavrmfvdagvevlvaqsfsknfglygerigclhvvhagvegsv
    eknkalsaamvsgmtlqirktwsmsaihgayivqvivhdkrllqmfydnvkemsarihrm
    rsllhaslakrktpgpgskgtwdhiltaigmftftgltpehvdylkekwsiylvkaggrm
    smcgltesncdyvaeaihdavtklpfkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mebA (A:)
    msvfsgfpasppdailnltvlynadtnpkkvnlgvgayrdesgkpwilpavkeaeaiiss
    dlskynkeyppvagfplfleaaqflmfgkdskaaqegriascqslsgtgslhigfeflhl
    wmpkaefympsttwpnhygiydkvfnklkvpykeytylrkdgeleidfsntkkdiqsape
    ksiflfhacahnpsgidfteaqwkellpimkekkhiaffdsayqgfatgsfeadafavrm
    fvdagvevlvaqsfsknfglygerigclhvvhagvegsveknkalsaamvsgmtlqirkt
    wsmsaihgayivqvivhdkrllqmfydnvkemsarihrmrsllhaslakrktpgpgskgt
    wdhiltaigmftftgltpehvdylkekwsiylvkaggrmsmcgltesncdyvaeaihdav
    tklpfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mebB (B:)
    mahhhhhhmgtleaqtqgpgsmsvfsgfpasppdailnltvlynadtnpkkvnlgvgayr
    desgkpwilpavkeaeaiissdlskynkeyppvagfplfleaaqflmfgkdskaaqegri
    ascqslsgtgslhigfeflhlwmpkaefympsttwpnhygiydkvfnklkvpykeytylr
    kdgeleidfsntkkdiqsapeksiflfhacahnpsgidfteaqwkellpimkekkhiaff
    dsayqgfatgsfeadafavrmfvdagvevlvaqsfsknfglygerigclhvvhagvegsv
    eknkalsaamvsgmtlqirktwsmsaihgayivqvivhdkrllqmfydnvkemsarihrm
    rsllhaslakrktpgpgskgtwdhiltaigmftftgltpehvdylkekwsiylvkaggrm
    smcgltesncdyvaeaihdavtklpfkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mebB (B:)
    msvfsgfpasppdailnltvlynadtnpkkvnlgvgayrdesgkpwilpavkeaeaiiss
    dlskynkeyppvagfplfleaaqflmfgkdskaaqegriascqslsgtgslhigfeflhl
    wmpkaefympsttwpnhygiydkvfnklkvpykeytylrkdgeleidfsntkkdiqsape
    ksiflfhacahnpsgidfteaqwkellpimkekkhiaffdsayqgfatgsfeadafavrm
    fvdagvevlvaqsfsknfglygerigclhvvhagvegsveknkalsaamvsgmtlqirkt
    wsmsaihgayivqvivhdkrllqmfydnvkemsarihrmrsllhaslakrktpgpgskgt
    wdhiltaigmftftgltpehvdylkekwsiylvkaggrmsmcgltesncdyvaeaihdav
    tklpfk