PDB entry 3me2

View 3me2 on RCSB PDB site
Description: Crystal structure of mouse RANKL-RANK complex
Class: cytokine/cytokine receptor
Keywords: RANK, RANKL, RANKL-RANK complex, TNFSF11, TNFRSF11a, TNF superfamily, CYTOKINE-CYTOKINE RECEPTOR complex
Deposited on 2010-03-31, released 2010-06-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.175
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor ligand superfamily member 11
    Species: Mus musculus [TaxId:10090]
    Gene: Opgl, Rankl, Tnfsf11, Trance
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3me2a_
  • Chain 'R':
    Compound: Tumor necrosis factor receptor superfamily member 11A
    Species: Mus musculus [TaxId:10090]
    Gene: Rank, Tnfrsf11a
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3me2A (A:)
gplgspefpgrrkpeaqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngkl
rvnqdgfyylyanicfrhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsg
nsefhfysinvggffklrageeisiqvsnpslldpdqdatyfgafkvqdid

    Sequence, based on observed residues (ATOM records): (download) 
    >3me2A (A:)
aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
klrageeisiqvsnpslldpdqdatyfgafkvqdid

  • Chain 'R':
    No sequence available.