PDB entry 3mdy

View 3mdy on RCSB PDB site
Description: Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1B (BMPR1B) in complex with FKBP12 and LDN-193189
Class: Transferase/isomerase
Keywords: COMPLEX (ISOMERASE-PROTEIN KINASE), RECEPTOR SERINE/THREONINE KINASE, Structural Genomics Consortium, SGC, ATP-binding, Disease mutation, Kinase, Transferase, Rotamase, Transferase-isomerase complex
Deposited on 2010-03-31, released 2010-05-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.204
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone morphogenetic protein receptor type-1B
    Species: Homo sapiens [TaxId:9606]
    Gene: BMPR1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3mdya_
  • Chain 'B':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP1A
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (1-108)
      • expression tag (0)
    Domains in SCOPe 2.04: d3mdyb_
  • Chain 'C':
    Compound: Bone morphogenetic protein receptor type-1B
    Species: Homo sapiens [TaxId:9606]
    Gene: BMPR1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3mdyc_
  • Chain 'D':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP1A
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (1-108)
      • expression tag (0)
    Domains in SCOPe 2.04: d3mdyd_
  • Heterogens: LDN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mdyA (A:)
    smtyippgeslrdlieqsqssgsgsglpllvqrtiakqiqmvkqigkgrygevwmgkwrg
    ekvavkvfftteeaswfreteiyqtvlmrhenilgfiaadikgtgswtqlylitdyheng
    slydylksttldaksmlklayssvsglchlhteifstqgkpaiahrdlksknilvkkngt
    cciadlglavkfisdtnevdippntrvgtkrymppevldeslnrnhfqsyimadmysfgl
    ilwevarrcvsggiveeyqlpyhdlvpsdpsyedmreivcikklrpsfpnrwssdeclrq
    mgklmtecwahnpasrltalrvkktlakmsesqdikl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mdyA (A:)
    eslrdlieqsqssgsgsglpllvqrtiakqiqmvkqigkgrygevwmgkwrgekvavkvf
    ftteeaswfreteiyqtvlmrhenilgfiaadikgtgswtqlylitdyhengslydylks
    ttldaksmlklayssvsglchlhteifstqgkpaiahrdlksknilvkkngtcciadlgl
    avkfipntrvgtkrymppevldeslnrnhfqsyimadmysfglilwevarrcvsggivee
    yqlpyhdlvpsdpsyedmreivcikklrpsfpnrwssdeclrqmgklmtecwahnpasrl
    talrvkktlakmsesqdikl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mdyB (B:)
    smgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirg
    weegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mdyC (C:)
    smtyippgeslrdlieqsqssgsgsglpllvqrtiakqiqmvkqigkgrygevwmgkwrg
    ekvavkvfftteeaswfreteiyqtvlmrhenilgfiaadikgtgswtqlylitdyheng
    slydylksttldaksmlklayssvsglchlhteifstqgkpaiahrdlksknilvkkngt
    cciadlglavkfisdtnevdippntrvgtkrymppevldeslnrnhfqsyimadmysfgl
    ilwevarrcvsggiveeyqlpyhdlvpsdpsyedmreivcikklrpsfpnrwssdeclrq
    mgklmtecwahnpasrltalrvkktlakmsesqdikl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mdyC (C:)
    eslrdlieqsqssgsgsglpllvqrtiakqiqmvkqigkgrygevwmgkwrgekvavkvf
    ftteeaswfreteiyqtvlmrhenilgfiaadikgtgswtqlylitdyhengslydylks
    ttldaksmlklayssvsglchlhteifstqgkpaiahrdlksknilvkkngtcciadlgl
    avkfiippntrvgtkrymppevldeslnrnhfqsyimadmysfglilwevarrcvsggiv
    eeyqlpyhdlvpsdpsyedmreivcikklrpsfpnrwssdeclrqmgklmtecwahnpas
    rltalrvkktlakmsesqdi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mdyD (D:)
    smgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirg
    weegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle