PDB entry 3mdx

View 3mdx on RCSB PDB site
Description: Crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from Brucella melitensis, rhombohedral crystal form
Class: hydrolase
Keywords: DEOXYURIDINE 5-TRIPHOSPHATE NUCLEOTIDOHYDROLASE, Hydrolase, Metal-binding, Nucleotide metabolism, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2010-03-31, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.151
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Brucella melitensis [TaxId:359391]
    Gene: dut, BAB1_1687
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mdxa_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mdxA (A:)
    mahhhhhhmgtleaqtqgpgsmtaasssaptlgiirlehakgldlpayetagsagmdlra
    avaedrqivllpgrrtlvptglileipqgyevqirprsglafkngitclntpgtidsdyr
    gevkvllinlgdddfriergmriaqavfapviqpkieerakisetargaggfgstgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mdxA (A:)
    aptlgiirlehakgldlpayetagsagmdlraavaedrqivllpgrrtlvptglileipq
    gyevqirprsglafkngitclntpgtidsdyrgevkvllinlgdddfriergmriaqavf
    apviqpkieerakrgaggf