PDB entry 3mdf

View 3mdf on RCSB PDB site
Description: Crystal structure of the RRM domain of Cyclophilin 33
Class: RNA binding protein
Keywords: RRM domain, PHD finger, Cyp33, MLL, RNA BINDING PROTEIN, Alternative splicing, Isomerase, mRNA processing, mRNA splicing, Nucleus, RNA-binding, Rotamase, Spliceosome
Deposited on 2010-03-30, released 2010-05-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.21
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase e
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIE, CYP33
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mdfa_
  • Chain 'B':
    Compound: peptidyl-prolyl cis-trans isomerase e
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIE, CYP33
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mdfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3mdfA (A:)
gsmattkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelae
daaaaidnmneselfgrtirvnlak

    Sequence, based on observed residues (ATOM records): (download) 
    >3mdfA (A:)
mattkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaeda
aaaidnmneselfgrtirvnlak

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3mdfB (B:)
gsmattkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelae
daaaaidnmneselfgrtirvnlak

    Sequence, based on observed residues (ATOM records): (download) 
    >3mdfB (B:)
mattkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaeda
aaaidnmneselfgrtirvnlak