PDB entry 3mde

View 3mde on RCSB PDB site
Description:
Deposited on 1994-07-13, released 1994-09-30
The last revision prior to the SCOP 1.71 freeze date was dated 1994-09-30, with a file datestamp of 1994-10-05.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.174
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d3mdea1, d3mdea2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d3mdeb1, d3mdeb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mdeA (A:)
    gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
    gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
    caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
    skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltgegagfkiamg
    tfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisflladmamkvelarl
    syqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfnteypveklmrdak
    iyqiyegtaqiqriiiarehigryk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mdeB (B:)
    gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
    gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
    caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
    skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltgegagfkiamg
    tfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisflladmamkvelarl
    syqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfnteypveklmrdak
    iyqiyegtaqiqriiiarehigryk