PDB entry 3mdd

View 3mdd on RCSB PDB site
Description: crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1994-07-13, released 1994-09-30
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.173
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: medium chain acyl-coa dehydrogenase
    Species: Sus scrofa
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41367 (0-384)
      • conflict (4)
      • conflict (247)
      • conflict (269)
      • conflict (295)
    Domains in SCOP 1.73: d3mdda1, d3mdda2
  • Chain 'B':
    Compound: medium chain acyl-coa dehydrogenase
    Species: Sus scrofa
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41367 (0-384)
      • conflict (4)
      • conflict (247)
      • conflict (269)
      • conflict (295)
    Domains in SCOP 1.73: d3mddb1, d3mddb2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mddA (A:)
    gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
    gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
    caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
    skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltgegagfkiamg
    tfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisflladmamkvelarl
    syqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfnteypveklmrdak
    iyqiyegtaqiqriiiarehigryk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mddB (B:)
    gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
    gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
    caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
    skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltgegagfkiamg
    tfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisflladmamkvelarl
    syqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfnteypveklmrdak
    iyqiyegtaqiqriiiarehigryk