PDB entry 3md3

View 3md3 on RCSB PDB site
Description: Crystal Structure of the First Two RRM Domains of Yeast Poly(U) Binding Protein (Pub1)
Class: RNA binding protein
Keywords: RRM, RNP, RBD, poly(U) binding, tandem, Acetylation, Cytoplasm, Nucleus, RNA-binding, RNA BINDING PROTEIN
Deposited on 2010-03-29, released 2010-05-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.218
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3md3a1, d3md3a2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3md3A (A:)
    rvlyvgnldkaitedilkqyfqvggpianikimidknnknvnyafveyhqshdanialqt
    lngkqiennivkinwafqsqqsssddtfnlfvgdlnvnvddetlrnafkdfpsylsghvm
    wdmqtgssrgygfvsftsqddaqnamdsmqgqdlngrplrinwaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3md3A (A:)
    rvlyvgnldkaitedilkqyfqvggpianikimidknknvnyafveyhqshdanialqtl
    ngkqiennivkinwafqsqqsssddtfnlfvgdlnvnvddetlrnafkdfpsylsghvmw
    dmqtgssrgygfvsftsqddaqnamdsmqgqdlngrplrinwaak