PDB entry 3mcy

View 3mcy on RCSB PDB site
Description: Crystal structure of FimH lectin domain bound to biphenyl mannoside meta-methyl ester.
Class: carbohydrate binding protein
Keywords: lectin, mannoside, immunogobulin fold, carbohydrate binding protein
Deposited on 2010-03-29, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.22
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mcya_
  • Chain 'B':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mcyb_
  • Chain 'C':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mcyc_
  • Chain 'D':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mcyd_
  • Heterogens: ZH1, GOL, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mcyA (A:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdyhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mcyA (A:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mcyB (B:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdyhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mcyB (B:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mcyC (C:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdyhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mcyC (C:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mcyD (D:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdyhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mcyD (D:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt