PDB entry 3mcl

View 3mcl on RCSB PDB site
Description: Anti-beta-amyloid antibody c706 fab in space group P21
Class: immune system
Keywords: immunoglobulin fold, monoclonal antibody, immune system
Deposited on 2010-03-29, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.205
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: c706 monoclonal heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3MCL (0-227)
  • Chain 'L':
    Compound: c706 monoclonal light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3MCL (0-End)
    Domains in SCOPe 2.07: d3mcll1, d3mcll2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mclL (L:)
    qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydssrlasgvpsr
    fsgggsgtsysltisnmeaedaatyfcqnwrssptfgagtklelkrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mclL (L:)
    qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydssrlasgvpsr
    fsgggsgtsysltisnmeaedaatyfcqnwrssptfgagtklelkrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnr