PDB entry 3mci

View 3mci on RCSB PDB site
Description: Crystal structure of molybdenum cofactor biosynthesis (AQ_061) from aquifex aeolicus VF5
Class: lyase
Keywords: Molybdopterin, MPT, Structural genomics, NPPSFA, National project on protein structural and functional analyses, RIKEN STructural genomics/proteomics initiative, RSGI, LYASE
Deposited on 2010-03-29, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.195
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum cofactor biosynthesis MOG
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: mog, aq_061
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mcia_
  • Chain 'B':
    Compound: Molybdenum cofactor biosynthesis MOG
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: mog, aq_061
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mcib_
  • Chain 'C':
    Compound: Molybdenum cofactor biosynthesis MOG
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: mog, aq_061
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mcic_
  • Heterogens: EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mciA (A:)
    msekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektl
    ieladekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsr
    qtagirgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mciA (A:)
    sekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektli
    eladekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrq
    tagirgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mciB (B:)
    msekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektl
    ieladekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsr
    qtagirgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mciB (B:)
    ekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektlie
    ladekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqt
    agirgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mciC (C:)
    msekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektl
    ieladekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsr
    qtagirgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mciC (C:)
    ekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektlie
    ladekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqt
    agirgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpk