PDB entry 3mcg

View 3mcg on RCSB PDB site
Description: three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1989-05-09, released 1990-10-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: immunoglobulin lambda dimer mcg (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR S14675 (1-215)
      • conflict (19)
      • conflict (22)
      • conflict (28)
      • conflict (30)
      • conflict (38)
      • conflict (41)
      • conflict (47-48)
      • conflict (53)
      • conflict (61)
      • conflict (93)
      • conflict (96-99)
      • conflict (102)
      • conflict (105-106)
      • conflict (115)
      • conflict (117)
      • conflict (155)
      • conflict (166)
    Domains in SCOPe 2.03: d3mcg11, d3mcg12
  • Chain '2':
    Compound: immunoglobulin lambda dimer mcg (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR S14675 (1-215)
      • conflict (19)
      • conflict (22)
      • conflict (28)
      • conflict (30)
      • conflict (38)
      • conflict (41)
      • conflict (47-48)
      • conflict (53)
      • conflict (61)
      • conflict (93)
      • conflict (96-99)
      • conflict (102)
      • conflict (105-106)
      • conflict (115)
      • conflict (117)
      • conflict (155)
      • conflict (166)
    Domains in SCOPe 2.03: d3mcg21, d3mcg22
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mcg1 (1:)
    esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mcg2 (2:)
    esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs