PDB entry 3mc4

View 3mc4 on RCSB PDB site
Description: Crystal structure of WW/RSP5/WWP domain: bacterial transferase hexapeptide repeat: serine O-Acetyltransferase from Brucella Melitensis
Class: transferase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, Acyltransferase, Transferase
Deposited on 2010-03-26, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.132
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WW/Rsp5/WWP domain:Bacterial transferase hexapeptide repeat:Serine O-acetyltransferase
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: BAB1_1281
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mc4a_
  • Chain 'B':
    Compound: WW/Rsp5/WWP domain:Bacterial transferase hexapeptide repeat:Serine O-acetyltransferase
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: BAB1_1281
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mc4b_
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mc4A (A:)
    mahhhhhhmgtleaqtqgpgsmnagldqvdpiwhsiraeaeeatrndpvlgaflyatiln
    qpsleeavmhriaerlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysr
    fmdpvlylkgfhaiqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfld
    hatglvvgetavvednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqc
    skiaagsvvlksvphnvtvagvpariigetgctepsrvmdqmlgdgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mc4A (A:)
    nagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvs
    adilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahw
    lykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhg
    vtlgggdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvparii
    getg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mc4B (B:)
    mahhhhhhmgtleaqtqgpgsmnagldqvdpiwhsiraeaeeatrndpvlgaflyatiln
    qpsleeavmhriaerlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysr
    fmdpvlylkgfhaiqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfld
    hatglvvgetavvednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqc
    skiaagsvvlksvphnvtvagvpariigetgctepsrvmdqmlgdgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mc4B (B:)
    dpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrqt
    fdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgrk
    dfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggtg
    drhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariigetg