PDB entry 3mc1

View 3mc1 on RCSB PDB site
Description: Crystal structure of a predicted phosphatase from Clostridium acetobutylicum
Class: hydrolase
Keywords: PSI2, NYSGXRC, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, HYDROLASE
Deposited on 2010-03-26, released 2010-04-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.224
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Predicted phosphatase, HAD family
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CA_C0418
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97LY2 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.01: d3mc1a_
  • Chain 'B':
    Compound: Predicted phosphatase, HAD family
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CA_C0418
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mc1b_
  • Heterogens: NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mc1A (A:)
    mslynyvlfdldgtltdsaegitksvkyslnkfdiqvedlsslnkfvgpplktsfmeyyn
    fdeetatvaidyyrdyfkakgmfenkvydgieallsslkdygfhlvvatskptvfskqil
    ehfklafyfdaivgssldgklstkedviryameslniksddaimigdreydvigalknnl
    psigvtygfgsyeelknaganyivnsvdelhkkilelreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mc1A (A:)
    slynyvlfdldgtltdsaegitksvkyslnkfdiqvedlsslnkfvgpplktsfmeyynf
    deetatvaidyyrdyfkakgmfenkvydgieallsslkdygfhlvvatskptvfskqile
    hfklafyfdaivgssldgklstkedviryameslniksddaimigdreydvigalknnlp
    sigvtygfgsyeelknaganyivnsvdelhkkilel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mc1B (B:)
    mslynyvlfdldgtltdsaegitksvkyslnkfdiqvedlsslnkfvgpplktsfmeyyn
    fdeetatvaidyyrdyfkakgmfenkvydgieallsslkdygfhlvvatskptvfskqil
    ehfklafyfdaivgssldgklstkedviryameslniksddaimigdreydvigalknnl
    psigvtygfgsyeelknaganyivnsvdelhkkilelreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mc1B (B:)
    ynyvlfdldgtltdsaegitksvkyslnkfdiqvedlsslnkfvgpplktsfmeyynfde
    etatvaidyyrdyfkakgmfenkvydgieallsslkdygfhlvvatskptvfskqilehf
    klafyfdaivgssldgklstkedviryameslniksddaimigdreydvigalknnlpsi
    gvtygfgsyeelknaganyivnsvdelhkkilelr