PDB entry 3mc0

View 3mc0 on RCSB PDB site
Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a Mouse T-cell Receptor beta Chain
Class: immune system
Keywords: IMMUNE SYSTEM, Exotoxin
Deposited on 2010-03-26, released 2010-10-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: variable beta 8.2 mouse T cell receptor
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTY6 (0-108)
      • engineered mutation (15)
      • engineered mutation (22)
      • engineered mutation (71)
      • engineered mutation (78)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (101)
      • engineered mutation (106)
    Domains in SCOPe 2.03: d3mc0a_
  • Chain 'B':
    Compound: Enterotoxin SEG
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3mc0b1, d3mc0b2
  • Chain 'C':
    Compound: variable beta 8.2 mouse T cell receptor
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTY6 (0-108)
      • engineered mutation (15)
      • engineered mutation (22)
      • engineered mutation (71)
      • engineered mutation (78)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (101)
      • engineered mutation (106)
    Domains in SCOPe 2.03: d3mc0c_
  • Chain 'D':
    Compound: Enterotoxin SEG
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3mc0d1, d3mc0d2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mc0A (A:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mc0B (B:)
    qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn
    evktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltfnssen
    erdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgy
    ikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnthhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mc0B (B:)
    qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn
    evktelentelannykgkkvdifgvpyfytciipksenfggccmyggltfnssenerdkl
    itvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgyikfte
    knntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mc0C (C:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mc0D (D:)
    qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn
    evktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltfnssen
    erdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgy
    ikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnthhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mc0D (D:)
    pdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyne
    vktelentelannykgkkvdifgvpyfytciipksenfggccmyggltfnssenerdkli
    tvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgyikftek
    nntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth