PDB entry 3mbw

View 3mbw on RCSB PDB site
Description: Crystal structure of the human ephrin A2 LBD and CRD domains in complex with ephrin A1
Class: transferase/signaling protein
Keywords: ATP-binding, kinase, nucleotide-binding, receptor, transferase, phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein, cysteine-rich domain, phosphoprotein, GPI-anchor, lipoprotein, transferase-signaling protein complex, Structural Genomics Consortium, SGC
Deposited on 2010-03-26, released 2010-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ECK, EPHA2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ephrin-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: EFNA1, EPLG1, LERK1, TNFAIP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3mbwb_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mbwB (B:)
    apehhhhhhdydipttenlyfqgamdaadrhtvfwnssnpkfrnedytihvqlndyvdii
    cphyedhsvadaameqyilylveheeyqlcqpqskdqvrwqcnrpsakhgpeklsekfqr
    ftpftlgkefkeghsyyyiskpihqhedrclrlkvtvsgkithspqahvnpqekrlaadd
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mbwB (B:)
    drhtvfwnssnpkfrnedytihvqlndyvdiicphyevadaameqyilylveheeyqlcq
    pqskdqvrwqcnrpsakhgpeklsekfqrftpftlgkefkeghsyyyiskpihqhedrcl
    rlkvtvs