PDB entry 3mbq

View 3mbq on RCSB PDB site
Description: Crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from Brucella melitensis, orthorhombic crystal form
Class: hydrolase
Keywords: ALS COLLABORATIVE CRYSTALLOGRAPHY, DEOXYURIDINE 5-TRIPHOSPHATE NUCLEOTIDOHYDROLASE, Hydrolase, Metal-binding, Nucleotide metabolism, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2010-03-25, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.169
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Brucella melitensis [TaxId:359391]
    Gene: dut, BAB1_1687
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mbqa_
  • Chain 'B':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Brucella melitensis [TaxId:359391]
    Gene: dut, BAB1_1687
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mbqb_
  • Chain 'C':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Brucella melitensis [TaxId:359391]
    Gene: dut, BAB1_1687
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mbqc_
  • Heterogens: SO4, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mbqA (A:)
    mahhhhhhmgtleaqtqgpgsmtaasssaptlgiirlehakgldlpayetagsagmdlra
    avaedrqivllpgrrtlvptglileipqgyevqirprsglafkngitclntpgtidsdyr
    gevkvllinlgdddfriergmriaqavfapviqpkieerakisetargaggfgstgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mbqA (A:)
    aptlgiirlehakgldlpayetagsagmdlraavaedrqivllpgrrtlvptglileipq
    gyevqirprsglafkngitclntpgtidsdyrgevkvllinlgdddfriergmriaqavf
    apviqpkieerakis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mbqB (B:)
    mahhhhhhmgtleaqtqgpgsmtaasssaptlgiirlehakgldlpayetagsagmdlra
    avaedrqivllpgrrtlvptglileipqgyevqirprsglafkngitclntpgtidsdyr
    gevkvllinlgdddfriergmriaqavfapviqpkieerakisetargaggfgstgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mbqB (B:)
    aptlgiirlehakgldlpayetagsagmdlraavaedrqivllpgrrtlvptglileipq
    gyevqirprsglafkngitclntpgtidsdyrgevkvllinlgdddfriergmriaqavf
    apviqpkieera
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mbqC (C:)
    mahhhhhhmgtleaqtqgpgsmtaasssaptlgiirlehakgldlpayetagsagmdlra
    avaedrqivllpgrrtlvptglileipqgyevqirprsglafkngitclntpgtidsdyr
    gevkvllinlgdddfriergmriaqavfapviqpkieerakisetargaggfgstgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mbqC (C:)
    aptlgiirlehakgldlpayetagsagmdlraavaedrqivllpgrrtlvptglileipq
    gyevqirprsglafkngitclntpgtidsdyrgevkvllinlgdddfriergmriaqavf
    apviqpkieerakigaggf