PDB entry 3mbl

View 3mbl on RCSB PDB site
Description: Crystal Structure of the human mitogen-activated protein kinase kinase 1 (MEK 1) in complex with ligand and MgADP
Class: transferase
Keywords: Kinase inhibitor, Transferase
Deposited on 2010-03-25, released 2010-07-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.169
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity mitogen-activated protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP2K1, MEK 1, MEK1, PRKMK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02750 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d3mbla_
  • Heterogens: ADP, MG, LSG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mblA (A:)
    melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
    cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
    rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthy
    svqsdiwsmglslvemavgrypipppdakelelmfgcqvegdaaetpprprtpgrplssy
    gmdsrppmaifelldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhaf
    ikrsdaeevdfagwlcstiglnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mblA (A:)
    melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
    cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
    rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthy
    svqsdiwsmglslvemavgrypipppdakelelmfpmaifelldyivnepppklpsgvfs
    lefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigl