PDB entry 3mba

View 3mba on RCSB PDB site
Description: aplysia limacina myoglobin. crystallographic analysis at 1.6 angstroms resolution
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1989-02-22, released 1990-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.142
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Aplysia limacina [TaxId:6502]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02210 (0-144)
      • conflict (21)
      • conflict (25-26)
      • conflict (79)
    Domains in SCOPe 2.05: d3mbaa_
  • Heterogens: F, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mbaA (A:)
    slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
    rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
    appagadaawtklfgliidalkaaga