PDB entry 3mac

View 3mac on RCSB PDB site
Description: crystal structure of GP41-derived protein complexed with fab 8062
Class: immune system
Keywords: GP41, fab8062, IMMUNE SYSTEM
Deposited on 2010-03-23, released 2010-12-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.202
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transmembrane glycoprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab8062
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MAC
  • Chain 'L':
    Compound: Fab8062
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MAC
    Domains in SCOPe 2.04: d3macl1, d3macl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3macL (L:)
    dieltqppsvsvvpgqtariscsgdnipyeyaswyqqkpgqapvlviygdnnrpsgiper
    fsgsnsgntatltisgtqaedeadyycaswdsmtvdgvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3macL (L:)
    ieltqppsvsvvpgqtariscsgdnipyeyaswyqqkpgqapvlviygdnnrpsgiperf
    sgsnsgntatltisgtqaedeadyycaswdsmtvdgvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt