PDB entry 3ma4

View 3ma4 on RCSB PDB site
Description: Crystal structure analysis of M32A mutant of human CLIC1
Class: transport protein
Keywords: CLIC, glutathione transferase, thioredoxin, domain interface interactions, lock and key motif, cell membrane, Chloride, Chloride channel, disulfide bond, ion transport, ionic channel, membrane, nucleus, phosphoprotein, transmembrane, transport, voltage-gated channel, TRANSPORT PROTEIN
Deposited on 2010-03-23, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.18
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIC1, NCC27
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00299 (0-235)
      • engineered mutation (26)
    Domains in SCOPe 2.07: d3ma4a1, d3ma4a2
  • Chain 'B':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIC1, NCC27
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00299 (0-235)
      • engineered mutation (26)
    Domains in SCOPe 2.07: d3ma4b1, d3ma4b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ma4A (A:)
    pqvelfvkagsdgakigncpfsqrlfavlwlkgvtfnvttvdtkrrtetvqklcpggqlp
    fllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayiknsnpal
    ndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnllpklh
    ivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvakalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ma4A (A:)
    pqvelfvkagsdgakigncpfsqrlfavlwlkgvtfnvttvdtkrrtetvqklcpggqlp
    fllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayiknsnpal
    ndnlekgllkalkvldnyltsplpeevdrkfldgneltladcnllpklhivqvvckkyrg
    ftipeafrgvhrylsnayareefastcpddeeielayeqvakalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ma4B (B:)
    pqvelfvkagsdgakigncpfsqrlfavlwlkgvtfnvttvdtkrrtetvqklcpggqlp
    fllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayiknsnpal
    ndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnllpklh
    ivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvakalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ma4B (B:)
    pqvelfvkagsdgakigncpfsqrlfavlwlkgvtfnvttvdtkrrtetvqklcpggqlp
    fllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayiknsnpal
    ndnlekgllkalkvldnyltsplprkfldgneltladcnllpklhivqvvckkyrgftip
    eafrgvhrylsnayareefastcpddeeielayeqvakalk