PDB entry 3m9y

View 3m9y on RCSB PDB site
Description: Crystal structure of Triosephosphate isomerase from methicillin resistant Staphylococcus aureus at 1.9 Angstrom resolution
Class: isomerase
Keywords: TIM barrel, glycolysis, Gluconeogenesis, Isomerase, Pentose shunt
Deposited on 2010-03-23, released 2011-04-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.161
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Staphylococcus aureus [TaxId:282458]
    Gene: SAR0830, tpi, tpiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GIL6 (1-253)
      • expression tag (0)
    Domains in SCOPe 2.01: d3m9ya_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Staphylococcus aureus [TaxId:282458]
    Gene: SAR0830, tpi, tpiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GIL6 (1-253)
      • expression tag (0)
    Domains in SCOPe 2.01: d3m9yb_
  • Heterogens: NA, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m9yA (A:)
    smrtpiiagnwkmnktvqeakdfvnalptlpdskevesvicapaiqldalttavkegkaq
    gleigaqntyfedngaftgetspvaladlgvkyvvighserrelfhetdeeinkkahaif
    khgmtpiicvgetdeeresgkandvvgeqvkkavaglsedqlksvviayepiwaigtgks
    stsedanemcafvrqtiadlsskevseatriqyggsvkpnnikeymaqtdidgalvggas
    lkvedfvqllegak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m9yA (A:)
    smrtpiiagnwkmnktvqeakdfvnalptlpdskevesvicapaiqldalttavkegkaq
    gleigaqntyfedngaftgetspvaladlgvkyvvighserrelfhetdeeinkkahaif
    khgmtpiicvgetdeeresgkandvvgeqvkkavaglsedqlksvviayepiwaigksst
    sedanemcafvrqtiadlsskevseatriqyggsvkpnnikeymaqtdidgalvggaslk
    vedfvqllegak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m9yB (B:)
    smrtpiiagnwkmnktvqeakdfvnalptlpdskevesvicapaiqldalttavkegkaq
    gleigaqntyfedngaftgetspvaladlgvkyvvighserrelfhetdeeinkkahaif
    khgmtpiicvgetdeeresgkandvvgeqvkkavaglsedqlksvviayepiwaigtgks
    stsedanemcafvrqtiadlsskevseatriqyggsvkpnnikeymaqtdidgalvggas
    lkvedfvqllegak