PDB entry 3m99

View 3m99 on RCSB PDB site
Description: Structure of the Ubp8-Sgf11-Sgf73-Sus1 SAGA DUB module
Class: transcription
Keywords: Zinc Finger, Activator, Chromatin regulator, Metal-binding, Nucleus, Transcription, Transcription regulation, Zinc-finger, mRNA transport, ubiquitination, deubiquitination, Nuclear pore complex, Protein modification
Deposited on 2010-03-21, released 2010-05-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.237
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: UBP8, YM9959.05, YMR223W
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: SAGA-associated factor 11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SGF11, YPL047W
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Protein SUS1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SUS1, YBR111W-A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m99c_
  • Chain 'D':
    Compound: SAGA-associated factor 73
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SGF73, SGF73 (AA 1-104), YGL066W
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3m99C (C:)
mtmdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftq
ilstvepkalemvsdstretvlkqirefleeivdtq

    Sequence, based on observed residues (ATOM records): (download) 
    >3m99C (C:)
aqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqilstv
epkalemvsdstretvlkqirefleeivdtq

  • Chain 'D':
    No sequence available.