PDB entry 3m8o

View 3m8o on RCSB PDB site
Description: Human IgA1 Fab fragment
Class: immune system
Keywords: Immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2010-03-18, released 2011-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.154
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Immunoglobulin A1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3M8O (0-220)
    Domains in SCOPe 2.06: d3m8oh1, d3m8oh2
  • Chain 'L':
    Compound: Immunoglobulin A1 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3M8O (0-218)
    Domains in SCOPe 2.06: d3m8ol1, d3m8ol2
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m8oH (H:)
    evqlvesggglvqpggslklscaasgftlsgsnvhwvrqasgkglewvgrikrnaesdat
    ayaasmrgrltisrddskntaflqmnslksddtamyycvirgdvynrqwgqgtlvtvssa
    sptspkvfplslcstqpdgnvviaclvqgffpqeplsvtwsesgqgvtarnfppsqdasg
    dlyttssqltlpatqclagksvtchvkhytnpsqdvtvpcp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m8oL (L:)
    divmtqsplslsvtpgepasiscrssqsllrrdghndlewylqkpgqspqpliylgstra
    sgvpdrfsgsgsgtdftlkiirveaedagtyycmqnkqtpltfgqgtrleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec