PDB entry 3m8m

View 3m8m on RCSB PDB site
Description: 1.05 A Structure of Manganese-free Manganese Peroxidase
Class: oxidoreductase
Keywords: Peroxidase, heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, high resolution, Calcium, Disulfide bond, Glycoprotein, Hydrogen peroxide, Iron, Lignin degradation, Manganese, Metal-binding, Oxidoreductase, Secreted
Deposited on 2010-03-18, released 2010-04-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.116
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Manganese peroxidase 1
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3m8ma_
  • Heterogens: MAN, CA, GOL, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m8mA (A:)
    avcpdgtrvshaaccafiplaqdlqetifqnecgedahevirltfhdaiaisrsqgpkag
    ggadgsmllfptvepnfsanngiddsvnnlipfmqkhntisaadlvqfagavalsncpga
    prleflagrpnktiaavdglipepqdsvtkilqrfedaggftpfevvsllashsvaradk
    vdqtidaapfdstpftfdtqvflevllkgvgfpgsanntgevasplplgsgsdtgemrlq
    sdfalahdprtaciwqgfvneqafmaasfraamsklavlghnrnslidcsdvvpvpkpat
    gqpamfpastgpqdlelscpserfptlttqpgasqsliahcpdgsmscpgvqfngpa