PDB entry 3m8b

View 3m8b on RCSB PDB site
Description: Crystal structure of spin-labeled BtuB V10R1 in the apo state
Class: transport protein
Keywords: beta barrel, R1, spin label, Cell membrane, Cell outer membrane, Ion transport, Membrane, Metal-binding, Phage recognition, Porin, Receptor, TonB box, Transmembrane, Transport, TRANSPORT PROTEIN
Deposited on 2010-03-17, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin B12 transporter btuB
    Species: Escherichia coli [TaxId:562]
    Gene: btuB, bfe, cer, dcrC, b3966, JW3938
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m8ba_
  • Heterogens: C8E, MTN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m8bA (A:)
    qdtspdtlvctanrfeqprstvlapttvvtrqdidrwqstsvndvlrrlpgvditqnggs
    gqlssifirgtnashvlvlidgvrlnlagvsgsadlsqfpialvqrveyirgprsavygs
    daiggvvniittrdepgteisagwgsnsyqnydvstqqqlgdktrvtllgdyahthgydv
    vaygntgtqaqtdndgflsktlygalehnftdawsgfvrgygydnrtnydayyspgspll
    dtrklysqswdaglryngeliksqlitsyshskdynydphygrydssatldemkqytvqw
    annvivghgsigagvdwqkqtttpgtgyvedgydqrntgiyltglqqvgdftfegaarsd
    dnsqfgrhgtwqtsagwefiegyrfiasygtsykapnlgqlygfygnpnldpekskqweg
    afegltagvnwrisgyrndvsdlidyddhtlkyynegkarikgveatanfdtgplthtvs
    ydyvdarnaitdtpllrrakqqvkyqldwqlydfdwgityqylgtrydkdyssypyqtvk
    mggvslwdlavaypvtshltvrgkianlfdkdyetvygyqtagreytlsgsytf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8bA (A:)
    dtlvctanrfeqprstvlapttvvtrqdidrwqstsvndvlrrlpgvditqnggsgqlss
    ifirgtnashvlvlidgvrlnlagvsgsadlsqfpialvqrveyirgprsavygsdaigg
    vvniittrdepgteisagwgsnsyqnydvstqqqlgdktrvtllgdyahthggflsktly
    galehnftdawsgfvrgygydnrtndtrklysqswdaglryngeliksqlitsyshskdy
    nyatldemkqytvqwannvivghgsigagvdwqkqtttpgtgyvedgydqrntgiyltgl
    qqvgdftfegaarsddnsqfgrhgtwqtsagwefiegyrfiasygtsykapnlgqlygfy
    gnpnldpekskqwegafegltagvnwrisgyrndvsdlidyddhtlkyynegkarikgve
    atanfdtgplthtvsydyvdarnaitdtpllrrakqqvkyqldwqlydfdwgityqylgt
    rydkdyssypyqtvkmggvslwdlavaypvtshltvrgkianlfdkdyetvygyqtagre
    ytlsgsytf