PDB entry 3m8a

View 3m8a on RCSB PDB site
Description: Crystal Structure of Swine Flu Virus NS1 N-Terminal RNA Binding Domain from H1N1 Influenza A/California/07/2009
Class: viral protein
Keywords: NS1, N-terminal RNA binding Domain, Influenza A virus, H1N1, Host cytoplasm, Host nucleus, Host-virus interaction, Interferon antiviral system evasion, RNA-binding, Center for Structural Genomics of Infectious Diseases, CSGID, VIRAL PROTEIN
Deposited on 2010-03-17, released 2010-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.172
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nonstructural protein 1
    Species: Influenza A virus [TaxId:641809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m8aa_
  • Chain 'B':
    Compound: nonstructural protein 1
    Species: Influenza A virus [TaxId:641809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m8ab_
  • Chain 'C':
    Compound: nonstructural protein 1
    Species: Influenza A virus [TaxId:641809]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W611 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3m8ac1, d3m8ac2
  • Chain 'D':
    Compound: nonstructural protein 1
    Species: Influenza A virus [TaxId:641809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m8ad_
  • Chain 'E':
    Compound: nonstructural protein 1
    Species: Influenza A virus [TaxId:641809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m8ae_
  • Chain 'F':
    Compound: nonstructural protein 1
    Species: Influenza A virus [TaxId:641809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m8af_
  • Chain 'G':
    Compound: nonstructural protein 1
    Species: Influenza A virus [TaxId:641809]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W611 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3m8ag1, d3m8ag2
  • Chain 'H':
    Compound: nonstructural protein 1
    Species: Influenza A virus [TaxId:641809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m8ah_
  • Chain 'I':
    Compound: nonstructural protein 1
    Species: Influenza A virus [TaxId:641809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m8ai_
  • Chain 'J':
    Compound: nonstructural protein 1
    Species: Influenza A virus [TaxId:641809]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W611 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3m8aj1, d3m8aj2
  • Chain 'K':
    Compound: nonstructural protein 1
    Species: Influenza A virus [TaxId:641809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m8ak_
  • Chain 'L':
    Compound: nonstructural protein 1
    Species: Influenza A virus [TaxId:641809]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W611 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3m8al1, d3m8al2
  • Heterogens: ACT, MLI, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m8aA (A:)
    snamdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldieta
    tlvgkqivewilkees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8aA (A:)
    mdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlv
    gkqivewilke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m8aB (B:)
    snamdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldieta
    tlvgkqivewilkees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8aB (B:)
    mdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlv
    gkqivewilke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3m8aC (C:)
    snamdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldieta
    tlvgkqivewilkees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8aC (C:)
    amdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatl
    vgkqivewilkee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3m8aD (D:)
    snamdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldieta
    tlvgkqivewilkees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8aD (D:)
    mdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlv
    gkqivewilke
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3m8aE (E:)
    snamdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldieta
    tlvgkqivewilkees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8aE (E:)
    mdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlv
    gkqivewilkee
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3m8aF (F:)
    snamdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldieta
    tlvgkqivewilkees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8aF (F:)
    mdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlv
    gkqivewilkee
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3m8aG (G:)
    snamdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldieta
    tlvgkqivewilkees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8aG (G:)
    amdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatl
    vgkqivewilkee
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3m8aH (H:)
    snamdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldieta
    tlvgkqivewilkees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8aH (H:)
    dsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlvg
    kqivewilkee
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3m8aI (I:)
    snamdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldieta
    tlvgkqivewilkees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8aI (I:)
    mdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlv
    gkqivewilkee
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3m8aJ (J:)
    snamdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldieta
    tlvgkqivewilkees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8aJ (J:)
    amdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatl
    vgkqivewilkee
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3m8aK (K:)
    snamdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldieta
    tlvgkqivewilkees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8aK (K:)
    mdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlv
    gkqivewilk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3m8aL (L:)
    snamdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldieta
    tlvgkqivewilkees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8aL (L:)
    amdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatl
    vgkqivewilkee