PDB entry 3m85

View 3m85 on RCSB PDB site
Description: Archaeoglobus fulgidus exosome y70a with RNA bound to the active site
Class: hydrolase/RNA
Keywords: exosome, RNA, Exonuclease, Hydrolase, Nuclease, HYDROLASE-RNA complex
Deposited on 2010-03-17, released 2010-04-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein AF_0206
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0206
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative uncharacterized protein AF_0206
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0206
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Putative uncharacterized protein AF_0206
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0206
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: probable exosome complex exonuclease 1
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29757
      • engineered (64)
    Domains in SCOPe 2.04: d3m85d1, d3m85d2
  • Chain 'E':
    Compound: probable exosome complex exonuclease 1
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29757
      • engineered (64)
    Domains in SCOPe 2.04: d3m85e1, d3m85e2
  • Chain 'F':
    Compound: probable exosome complex exonuclease 1
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29757
      • engineered (64)
    Domains in SCOPe 2.04: d3m85f1, d3m85f2
  • Chain 'G':
    Compound: probable exosome complex exonuclease 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0494
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29756 (0-End)
      • engineered (69)
    Domains in SCOPe 2.04: d3m85g1, d3m85g2
  • Chain 'H':
    Compound: probable exosome complex exonuclease 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0494
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29756 (0-End)
      • engineered (69)
    Domains in SCOPe 2.04: d3m85h1, d3m85h2
  • Chain 'I':
    Compound: probable exosome complex exonuclease 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0494
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29756 (0-258)
      • engineered (69)
    Domains in SCOPe 2.04: d3m85i1, d3m85i2
  • Chain 'X':
    Compound: 5'-r(*cp*up*cp*cp*cp*c)-3'
  • Chain 'Y':
    Compound: 5'-r(*cp*up*cp*cp*cp*c)-3'
  • Chain 'Z':
    Compound: 5'-r(*cp*up*cp*cp*cp*c)-3'
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3m85D (D:)
    msefnekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgpr
    evhpehlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfpr
    saidifvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeed
    nfgeadmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrr
    yievgeemdeiteggeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m85D (D:)
    peklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhpehl
    qdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidifv
    evlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeednfgeadm
    pfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrryievgee
    mde
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3m85E (E:)
    msefnekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgpr
    evhpehlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfpr
    saidifvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeed
    nfgeadmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrr
    yievgeemdeiteggeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m85E (E:)
    ekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhpe
    hlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidi
    fvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeednfgea
    dmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrryievg
    eemde
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3m85F (F:)
    msefnekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgpr
    evhpehlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfpr
    saidifvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeed
    nfgeadmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrr
    yievgeemdeiteggeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m85F (F:)
    peklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhpehl
    qdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidifv
    evlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeednfgeadm
    pfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrryievgee
    mdeite
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3m85G (G:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepapdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfkei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m85G (G:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepapdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfke
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3m85H (H:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepapdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfkei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m85H (H:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepapdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfke
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m85I (I:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepapdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfkei
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.