PDB entry 3m82

View 3m82 on RCSB PDB site
Description: Crystal structure of Acetyl xylan esterase (TM0077) from THERMOTOGA MARITIMA at 2.40 A resolution (PMSF inhibitor complex structure)
Class: hydrolase
Keywords: Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, AXE1, HYDROLASE
Deposited on 2010-03-17, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl xylan esterase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0077, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m82a_
  • Chain 'B':
    Compound: acetyl xylan esterase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0077, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m82b_
  • Chain 'C':
    Compound: acetyl xylan esterase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0077, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m82c_
  • Chain 'D':
    Compound: acetyl xylan esterase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0077, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m82d_
  • Chain 'E':
    Compound: acetyl xylan esterase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0077, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m82e_
  • Chain 'F':
    Compound: acetyl xylan esterase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0077, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m82f_
  • Heterogens: CA, ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m82A (A:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m82A (A:)
    ffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfs
    gyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgs
    gwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqeri
    viaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdk
    eeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynn
    hegggsfqaveqvkflkklfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m82B (B:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m82B (B:)
    ffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfs
    gyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgs
    gwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqeri
    viaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdk
    eeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynn
    hegggsfqaveqvkflkklfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3m82C (C:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m82C (C:)
    ffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfs
    gyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgs
    gwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqeri
    viaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdk
    eeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynn
    hegggsfqaveqvkflkklfe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3m82D (D:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m82D (D:)
    ffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfs
    gyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgs
    gwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqeri
    viaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdk
    eeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynn
    hegggsfqaveqvkflkklfe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3m82E (E:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m82E (E:)
    ffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfs
    gyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgs
    gwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqeri
    viaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdk
    eeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynn
    hegggsfqaveqvkflkklfe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3m82F (F:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m82F (F:)
    ffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfs
    gyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgs
    gwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqeri
    viaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdk
    eeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynn
    hegggsfqaveqvkflkklfe