PDB entry 3m7t

View 3m7t on RCSB PDB site
Description: Crystal Structure of Alpha-Lytic Protease SB2+3 E8A/R105S Mutant
Class: hydrolase
Keywords: Hydrolase, Disulfide bond, Protease, Serine protease, Zymogen
Deposited on 2010-03-17, released 2011-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.138
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lytic protease
    Species: Lysobacter enzymogenes [TaxId:69]
    Gene: alpha-LP, Lysobacter
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00778 (0-197)
      • engineered (7)
      • engineered (104)
    Domains in SCOPe 2.08: d3m7ta_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m7tA (A:)
    anivggiaysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
    gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgsttgyqcgtitaknvt
    anyaegavrgltqgnacmgrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
    ferlqpilsqyglslvtg