PDB entry 3m7r

View 3m7r on RCSB PDB site
Description: Crystal structure of VDR H305Q mutant
Class: transcription
Keywords: Ligand binding domain, TRANSCRIPTION, Structural Genomics, SPINE, Structural Proteomics in Europe
Deposited on 2010-03-17, released 2010-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.211
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Nr1i1, Vdr
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11473 (0-252)
      • engineered (134)
    Domains in SCOPe 2.07: d3m7ra_
  • Heterogens: VDX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m7rA (A:)
    lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
    adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
    qdykyrvsdvtkagqslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
    lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
    smkltplvlevfg