PDB entry 3m7q

View 3m7q on RCSB PDB site
Description: Crystal structure of recombinant Kunitz Type serine protease Inhibitor-1 from the Caribbean sea anemone stichodactyla helianthus in complex with bovine pancreatic trypsin
Class: Hydrolase/Hydrolase inhibitor
Keywords: Trypsin-Inhibitor complex, Kunitz-type serine-protease inhibitor, Digestion, Disulfide bond, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen, Nematocyst, Protease inhibitor, Serine protease inhibitor, Hydrolase-Hydrolase inhibitor complex
Deposited on 2010-03-17, released 2011-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.159
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m7qa_
  • Chain 'B':
    Compound: Kunitz-type proteinase inhibitor SHPI-1
    Species: Stichodactyla helianthus [TaxId:6123]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31713 (4-58)
      • expression tag (0-3)
      • expression tag (59-60)
    Domains in SCOPe 2.07: d3m7qb1, d3m7qb2, d3m7qb3
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m7qA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m7qB (B:)
    eaeasicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicral
    g