PDB entry 3m7n

View 3m7n on RCSB PDB site
Description: archaeoglobus fulgidus exosome with RNA bound to the active site
Class: hydrolase/RNA
Keywords: exosome, RNA, Exonuclease, Hydrolase, Nuclease, HYDROLASE-RNA complex
Deposited on 2010-03-16, released 2010-04-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein AF_0206
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0206
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative uncharacterized protein AF_0206
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0206
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Putative uncharacterized protein AF_0206
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0206
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: probable exosome complex exonuclease 1
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29757
      • engineered (64)
    Domains in SCOPe 2.04: d3m7nd1, d3m7nd2
  • Chain 'E':
    Compound: probable exosome complex exonuclease 1
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29757
      • engineered (64)
    Domains in SCOPe 2.04: d3m7ne1, d3m7ne2
  • Chain 'F':
    Compound: probable exosome complex exonuclease 1
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29757
      • engineered (64)
    Domains in SCOPe 2.04: d3m7nf1, d3m7nf2
  • Chain 'G':
    Compound: probable exosome complex exonuclease 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0494
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3m7ng1, d3m7ng2
  • Chain 'H':
    Compound: probable exosome complex exonuclease 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0494
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3m7nh1, d3m7nh2
  • Chain 'I':
    Compound: probable exosome complex exonuclease 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0494
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3m7ni1, d3m7ni2
  • Chain 'X':
    Compound: 5'-r(*c*up*cp*cp*cp*c)-3'
  • Chain 'Y':
    Compound: 5'-r(*c*up*cp*cp*cp*c)-3'
  • Chain 'Z':
    Compound: 5'-r(*c*up*cp*cp*cp*c)-3'
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3m7nD (D:)
    msefnekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgpr
    evhpehlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfpr
    saidifvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeed
    nfgeadmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrr
    yievgeemdeiteggeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m7nD (D:)
    peklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhpehl
    qdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidifv
    evlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeednfgeadm
    pfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrryievgee
    mde
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3m7nE (E:)
    msefnekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgpr
    evhpehlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfpr
    saidifvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeed
    nfgeadmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrr
    yievgeemdeiteggeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m7nE (E:)
    ekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhpe
    hlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidi
    fvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeednfgea
    dmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrryievg
    eemdeite
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3m7nF (F:)
    msefnekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgpr
    evhpehlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfpr
    saidifvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeed
    nfgeadmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrr
    yievgeemdeiteggeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m7nF (F:)
    peklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhpehl
    qdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidifv
    evlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeednfgeadm
    pfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrryievgee
    mdeite
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3m7nG (G:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfkei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m7nG (G:)
    dilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgvk
    mqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavdlsk
    lvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpvrdl
    pvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfdelld
    vsincarklrekfk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3m7nH (H:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfkei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m7nH (H:)
    pedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvg
    vkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavdl
    sklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpvr
    dlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfdel
    ldvsincarklrekfkei
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3m7nI (I:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfkei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m7nI (I:)
    pedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvg
    vkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavdl
    sklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpvr
    dlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfdel
    ldvsincarklrekfkei
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.