PDB entry 3m7f

View 3m7f on RCSB PDB site
Description: Crystal structure of the Nedd4 C2/Grb10 SH2 complex
Class: signaling protein/ligase
Keywords: Nedd4, C2 domain, Grb10, SH2 domain, Phosphoprotein, Ligase, Ubl conjugation pathway, SIGNALING PROTEIN-LIGASE complex
Deposited on 2010-03-16, released 2010-10-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 10
    Species: Mus musculus [TaxId:10090]
    Gene: Grb10, Kiaa0093, Meg1, Nedd-4, Nedd4, Nedd4a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60760 (0-End)
      • see remark 999 (69)
    Domains in SCOPe 2.08: d3m7fa_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase NEDD4
    Species: Mus musculus [TaxId:10090]
    Gene: Grb10, Kiaa0093, Meg1, Nedd-4, Nedd4, Nedd4a
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3m7fA (A:)
ihrtqhwfhgrisreeshriikqqglvdglfllrdsqsnpkafvltlchhqkiknfqilp
ceddgqtffslddgntkfsdliqlvdfyqlnkgvlpcklkhhcirval

    Sequence, based on observed residues (ATOM records): (download) 
    >3m7fA (A:)
ihrtqhwfhgrisreeshriikqqglvdglfllrdsqsnpkafvltlchhqkiknfqilp
ceddgqtffslddgntkfsdliqlvdfyqlnkgvlpcklkhhcirva

  • Chain 'B':
    No sequence available.