PDB entry 3m79

View 3m79 on RCSB PDB site
Description: A tetrameric Zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces crystallized in the presence of Cu(II) and Zn(II)
Class: oxidoreductase
Keywords: Tetramer of Four Helix Bundles, Electron transport, Heme, Iron, Metal-binding, Transport, OXIDOREDUCTASE
Deposited on 2010-03-16, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.225
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (95)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m79a_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (95)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m79b_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (95)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m79c_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (95)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m79d_
  • Chain 'E':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (95)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m79e_
  • Chain 'F':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (95)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m79f_
  • Chain 'G':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (95)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m79g_
  • Chain 'H':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (95)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m79h_
  • Heterogens: HEM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m79A (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m79B (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m79C (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m79D (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m79E (E:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m79F (F:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m79G (G:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m79H (H:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr