PDB entry 3m6s

View 3m6s on RCSB PDB site
Description: Crystal structure of H1N1pdm Hemagglutinin
Class: viral protein
Keywords: Influenza virus, Hemagglutinin, pandemic, Envelope protein, Fusion protein, Host cell membrane, Host membrane, Membrane, Transmembrane, Virion, VIRAL PROTEIN
Deposited on 2010-03-16, released 2010-03-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.231
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:650110]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5MV42 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.05: d3m6sa_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:650110]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3m6sb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:650110]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5MV42 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.05: d3m6sc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:650110]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3m6sd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:650110]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5MV42 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.05: d3m6se_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:650110]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3m6sf_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:650110]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3m6sg_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:650110]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3m6sh_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:650110]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5MV42 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.05: d3m6si_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:650110]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3m6sj_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:650110]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3m6sk_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:650110]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3m6sl_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m6sA (A:)
    adpgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcn
    iagwilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfei
    fpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvl
    wgihhpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvep
    gdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnih
    pitigkcpkyvkstklrlatglrnvpsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6sA (A:)
    dpgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcni
    agwilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeif
    pktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlw
    gihhpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvepg
    dkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihp
    itigkcpkyvkstklrlatglrnvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m6sB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6sB (B:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3m6sC (C:)
    adpgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcn
    iagwilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfei
    fpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvl
    wgihhpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvep
    gdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnih
    pitigkcpkyvkstklrlatglrnvpsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6sC (C:)
    gdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
    wilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpk
    tsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgi
    hhpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvepgdk
    itfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpit
    igkcpkyvkstklrlatglrnvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3m6sD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6sD (D:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnree
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3m6sE (E:)
    adpgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcn
    iagwilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfei
    fpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvl
    wgihhpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvep
    gdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnih
    pitigkcpkyvkstklrlatglrnvpsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6sE (E:)
    gdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
    wilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpk
    tsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgi
    hhpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvepgdk
    itfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpit
    igkcpkyvkstklrlatglrnvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3m6sF (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6sF (F:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnree
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3m6sG (G:)
    adpgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcn
    iagwilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfei
    fpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvl
    wgihhpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvep
    gdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnih
    pitigkcpkyvkstklrlatglrnvpsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6sG (G:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnvp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3m6sH (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6sH (H:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3m6sI (I:)
    adpgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcn
    iagwilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfei
    fpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvl
    wgihhpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvep
    gdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnih
    pitigkcpkyvkstklrlatglrnvpsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6sI (I:)
    gdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
    wilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpk
    tsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgi
    hhpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvepgdk
    itfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpit
    igkcpkyvkstklrlatglrnv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3m6sJ (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6sJ (J:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3m6sK (K:)
    adpgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcn
    iagwilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfei
    fpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvl
    wgihhpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvep
    gdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnih
    pitigkcpkyvkstklrlatglrnvpsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6sK (K:)
    tlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagwi
    lgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpkts
    swpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihh
    pstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvepgdkit
    featgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitig
    kcpkyvkstklrlatglrnvp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3m6sL (L:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6sL (L:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnree