PDB entry 3m6c

View 3m6c on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis GroEL1 apical domain
Class: chaperone
Keywords: Chaperone, ATP-binding, Nucleotide-binding
Deposited on 2010-03-15, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60 kDa chaperonin 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: groEL-1, groEL1, groL1, MT3526, MTCY78.12, Rv3417c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m6ca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m6cA (A:)
    eleftegigfdkgflsayfvtdfdnqqavledalillhqdkisslpdllpllekvagtgk
    pllivaedvegealatlvvnairktlkavavkgpyfgdrrkafledlavvtggqvvnpda
    gmvlrevglevlgsarrvvvskddtvivdgggtaeavanrakhlraeidksdsdwdrekl
    gerlaklaggvavi