PDB entry 3m62
View 3m62 on RCSB PDB site
Description: Crystal structure of Ufd2 in complex with the ubiquitin-like (UBL) domain of Rad23
Class: ligase/protein binding
Keywords: Armadillo-like repeats, Ubl conjugation pathway, DNA damage, DNA repair, Nucleus, Phosphoprotein, LIGASE-PROTEIN BINDING complex
Deposited on
2010-03-15, released
2010-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ubiquitin conjugation factor E4
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: D1255, UFD2, YDL190C
Database cross-references and differences (RAF-indexed):
- Uniprot P54860 (7-End)
- expression tag (1-6)
- engineered (108)
- engineered (683)
- Chain 'B':
Compound: UV excision repair protein RAD23
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: RAD23, SYGP-ORF29, YEL037C
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3m62b_ - Heterogens: 1PE, K, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3m62B (B:)
mvsltfknfkkekvpldlepsntiletktklaqsisceesqikliysgkvlqdsktvsec
glkdgdqvvfmvsqkkstktkvterdpnsssvdklaaalehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>3m62B (B:)
sltfknfkkekvpldlepsntiletktklaqsisceesqikliysgkvlqdsktvsecgl
kdgdqvvfmvsq