PDB entry 3m5u

View 3m5u on RCSB PDB site
Description: Crystal Structure of Phosphoserine Aminotransferase from Campylobacter jejuni
Class: transferase
Keywords: alpha-beta half sandwich, CSGID, Amino-acid biosynthesis, Aminotransferase, Cytoplasm, Pyridoxal phosphate, Pyridoxine biosynthesis, Serine biosynthesis, Transferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases
Deposited on 2010-03-13, released 2010-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.172
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj0326, serC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m5ua_
  • Chain 'B':
    Compound: phosphoserine aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj0326, serC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m5ub_
  • Heterogens: GOL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m5uA (A:)
    snamrkinfsagpstlpleileqaqkelcdyqgrgysimeishrtkvfeevhfgaqekak
    klyelnddyevlflqggaslqfamipmnlalngvceyantgvwtkkaikeaqilgvnvkt
    vasseesnfdhiprvefsdnadyayicsnntiygtqyqnypktktplivdassdffsrkv
    dfsnialfyggvqknagisglscifirkdmlersknkqipsmlnylthaenqslfntppt
    faiymfnlemdwllnqggldkvheknsqkatmlyecidlsngfykghadkkdrslmnvsf
    niaknkdleplfvkeaeeagmiglkghrilggirasiynalnldqvktlcefmkefqgky
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5uA (A:)
    mrkinfsagpstlpleileqaqkelcdyqgrgysimeishrtkvfeevhfgaqekakkly
    elnddyevlflqggaslqfamipmnlalngvceyantgvwtkkaikeaqilgvnvktvas
    seesnfdhiprvefsdnadyayicsnntiygtqyqnypktktplivdassdffsrkvdfs
    nialfyggvqknagisglscifirkdmlersknkqipsmlnylthaenqslfntpptfai
    ymfnlemdwllnqggldkvheknsqkatmlyecidlsngfykghadkkdrslmnvsfnia
    knkdleplfvkeaeeagmiglkghrilggirasiynalnldqvktlcefmkefqgkya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m5uB (B:)
    snamrkinfsagpstlpleileqaqkelcdyqgrgysimeishrtkvfeevhfgaqekak
    klyelnddyevlflqggaslqfamipmnlalngvceyantgvwtkkaikeaqilgvnvkt
    vasseesnfdhiprvefsdnadyayicsnntiygtqyqnypktktplivdassdffsrkv
    dfsnialfyggvqknagisglscifirkdmlersknkqipsmlnylthaenqslfntppt
    faiymfnlemdwllnqggldkvheknsqkatmlyecidlsngfykghadkkdrslmnvsf
    niaknkdleplfvkeaeeagmiglkghrilggirasiynalnldqvktlcefmkefqgky
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5uB (B:)
    mrkinfsagpstlpleileqaqkelcdyqgrgysimeishrtkvfeevhfgaqekakkly
    elnddyevlflqggaslqfamipmnlalngvceyantgvwtkkaikeaqilgvnvktvas
    seesnfdhiprvefsdnadyayicsnntiygtqyqnypktktplivdassdffsrkvdfs
    nialfyggvqknagisglscifirkdmlersknkqipsmlnylthaenqslfntpptfai
    ymfnlemdwllnqggldkvheknsqkatmlyecidlsngfykghadkkdrslmnvsfnia
    knkdleplfvkeaeeagmiglkghrilggirasiynalnldqvktlcefmkefqgkya