PDB entry 3m5i

View 3m5i on RCSB PDB site
Description: Crystal structure of a H7 influenza virus hemagglutinin complexed with 6SLN
Class: viral protein
Keywords: Influenza virus, hemagglutinin, 6SLN, Envelope protein, Fusion protein, Host cell membrane, Host membrane, Membrane, Transmembrane, Virion, VIRAL PROTEIN
Deposited on 2010-03-12, released 2010-09-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.208
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:490450]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7NY59 (3-End)
      • see remark 999 (210)
      • see remark 999 (243)
      • see remark 999 (295)
    Domains in SCOPe 2.06: d3m5ia_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:490450]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m5ib_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:490450]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7NY59 (3-End)
      • see remark 999 (210)
      • see remark 999 (243)
      • see remark 999 (295)
    Domains in SCOPe 2.06: d3m5ic_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:490450]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m5id_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:490450]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7NY59 (3-End)
      • see remark 999 (210)
      • see remark 999 (243)
      • see remark 999 (295)
    Domains in SCOPe 2.06: d3m5ie_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:490450]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m5if_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m5iA (A:)
    adpgdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgl
    lgtligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgft
    ysgirtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhs
    esvseqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafia
    pdrtsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqks
    lllatgmrnvpekpkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5iA (A:)
    gdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgllgt
    ligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgftysg
    irtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhsesv
    seqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafiapdr
    tsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqkslll
    atgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m5iB (B:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
    qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
    rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriqidsgrlvp
    rg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5iB (B:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
    qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
    rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriqids
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3m5iC (C:)
    adpgdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgl
    lgtligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgft
    ysgirtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhs
    esvseqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafia
    pdrtsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqks
    lllatgmrnvpekpkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5iC (C:)
    gdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgllgt
    ligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgftysg
    irtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhsesv
    seqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafiapdr
    tsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqkslll
    atgmrnvpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3m5iD (D:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
    qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
    rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriqidsgrlvp
    rg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5iD (D:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
    qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
    rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3m5iE (E:)
    adpgdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgl
    lgtligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgft
    ysgirtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhs
    esvseqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafia
    pdrtsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqks
    lllatgmrnvpekpkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5iE (E:)
    gdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgllgt
    ligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgftysg
    irtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhsesv
    seqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafiapdr
    tsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqkslll
    atgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3m5iF (F:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
    qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
    rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriqidsgrlvp
    rg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5iF (F:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
    qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
    rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnri