PDB entry 3m5h

View 3m5h on RCSB PDB site
Description: Crystal structure of a H7 influenza virus hemagglutinin complexed with 3SLN
Class: viral protein
Keywords: Influenza virus, Hemagglutinin, 3SLN, Envelope protein, Fusion protein, Host cell membrane, Host membrane, Membrane, Transmembrane, Virion, VIRAL PROTEIN
Deposited on 2010-03-12, released 2010-09-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:490450]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7NY59 (3-End)
      • see remark 999 (210)
      • see remark 999 (243)
      • see remark 999 (295)
    Domains in SCOPe 2.06: d3m5ha_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:490450]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7NYS1 (0-End)
      • see remark 999 (175)
    Domains in SCOPe 2.06: d3m5hb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:490450]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7NY59
      • see remark 999 (210)
      • see remark 999 (243)
      • see remark 999 (295)
    Domains in SCOPe 2.06: d3m5hc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:490450]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m5hd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:490450]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7NY59 (3-End)
      • see remark 999 (210)
      • see remark 999 (243)
      • see remark 999 (295)
    Domains in SCOPe 2.06: d3m5he_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:490450]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m5hf_
  • Heterogens: NAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m5hA (A:)
    adpgdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgl
    lgtligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgft
    ysgirtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhs
    esvseqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafia
    pdrtsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqks
    lllatgmrnvpekpkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5hA (A:)
    gdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgllgt
    ligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgftysg
    irtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhsesv
    seqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafiapdr
    tsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqkslll
    atgmrnvpek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m5hB (B:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
    qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
    rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriqidsgrlvp
    rg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5hB (B:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
    qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
    rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriqidsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3m5hC (C:)
    adpgdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgl
    lgtligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgft
    ysgirtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhs
    esvseqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafia
    pdrtsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqks
    lllatgmrnvpekpkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5hC (C:)
    dkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgllgtl
    igppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgftysgi
    rtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhsesvs
    eqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafiapdrt
    sffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqksllla
    tgmrnvpek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3m5hD (D:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
    qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
    rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriqidsgrlvp
    rg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5hD (D:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
    qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
    rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3m5hE (E:)
    adpgdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgl
    lgtligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgft
    ysgirtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhs
    esvseqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafia
    pdrtsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqks
    lllatgmrnvpekpkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5hE (E:)
    gdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgllgt
    ligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgftysg
    irtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhsesv
    seqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafiapdr
    tsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqkslll
    atgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3m5hF (F:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
    qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
    rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriqidsgrlvp
    rg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5hF (F:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
    qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
    rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnri