PDB entry 3m52
View 3m52 on RCSB PDB site
Description: Crystal structure of the BTB domain from the Miz-1/ZBTB17 transcription regulator
Class: transcription
Keywords: BTB domain, POZ domain, BTB/POZ domain, Miz-1, Zinc finger protein 151, Myc-interacting zinc finger protein, Miz-1 protein, ZFP151, ZFP-151, ZNF151, MIZ1, Zinc finger and BTB domain-containing protein 17, Zinc finger protein 60, Protein-protein interaction domain, transcription regulator, transcription activator, ZINC-FINGER PROTEIN, alpha/beta protein, Developmental protein, DNA-binding, Metal-binding, Nucleus, Transcription, Transcription regulation, Zinc-finger, DNA BINDING PROTEIN
Deposited on
2010-03-12, released
2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated
2010-07-28, with a file datestamp of
2010-07-23.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.227
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Zinc finger and BTB domain-containing protein 17
Species: Homo sapiens [TaxId:9606]
Gene: MIZ1, ZBTB17, ZNF151, ZNF60
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3m52a1, d3m52a2 - Chain 'B':
Compound: Zinc finger and BTB domain-containing protein 17
Species: Homo sapiens [TaxId:9606]
Gene: MIZ1, ZBTB17, ZNF151, ZNF60
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3m52b1, d3m52b2 - Heterogens: ZN, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3m52A (A:)
gsmdfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkd
vvhldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitachalksla
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3m52B (B:)
gsmdfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkd
vvhldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitachalksla