PDB entry 3m4z

View 3m4z on RCSB PDB site
Description: Crystal Structure of B. subtilis ferrochelatase with Cobalt bound at the active site
Class: lyase
Keywords: COBALT, METAL-BINDING, ROSSMANN FOLD, PI-HELIX, LYASE, Heme biosynthesis, Iron, Porphyrin biosynthesis
Deposited on 2010-03-12, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.17
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: hemF, hemH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m4za_
  • Heterogens: CO, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3m4zA (A:)
srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs
vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
ahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
tvvlkklgr