PDB entry 3m4c

View 3m4c on RCSB PDB site
Description: A Zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase
Class: electron transport
Keywords: Four-helix bundle, Electron transport, Heme, Metal-binding, Transport
Deposited on 2010-03-10, released 2011-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65-66)
      • engineered (68)
      • engineered (72-73)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m4ca_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65-66)
      • engineered (68)
      • engineered (72-73)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m4cb_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65-66)
      • engineered (68)
      • engineered (72-73)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m4cc_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65-66)
      • engineered (68)
      • engineered (72-73)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m4cd_
  • Chain 'E':
    Compound: Heme-Peptide Fragment
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3M4C (0-8)
  • Heterogens: HEM, ACT, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m4cA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwcligqihaalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m4cB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwcligqihaalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m4cC (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwcligqihaalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m4cD (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwcligqihaalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'E':
    No sequence available.