PDB entry 3m43

View 3m43 on RCSB PDB site
Description: Crystal structure of the mutant I199A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum
Class: lyase
Keywords: orotidine 5'-monophosphate decarboxylase, mutant I199A, LYASE
Deposited on 2010-03-10, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.21
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered (100)
      • engineered (198)
    Domains in SCOPe 2.07: d3m43a_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered (100)
      • engineered (198)
    Domains in SCOPe 2.07: d3m43b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m43A (A:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaaivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m43A (A:)
    rvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfg
    criiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfllt
    emshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisptlrf
    adaaivgrsiyladnpaaaaagiiesi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m43B (B:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaaivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m43B (B:)
    rvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfg
    criiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfllt
    emshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisptlrf
    adaaivgrsiyladnpaaaaagiiesik